UPF3B antibody

Catalog No. ABIN629921

Product Details anti-UPF3B Antibody

Target: UPF3B (UPF3 Regulator of Nonsense Transcripts Homolog B (UPF3B))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UPF3B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: UPF3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UPF3B Blocking Peptide, catalog no. 33R-6132, is also available for use as a blocking control in assays to test for specificity of this UPF3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UPF3B

Target: UPF3B (UPF3 Regulator of Nonsense Transcripts Homolog B (UPF3B))

Alternative Name: UPF3B (UPF3B Products)

Synonyms: HUPF3B antibody, MRXS14 antibody, RENT3B antibody, UPF3X antibody, 5730594O13Rik antibody, AI317193 antibody, AW541158 antibody, RGD1560264 antibody, UPF3B, regulator of nonsense mediated mRNA decay antibody, UPF3 regulator of nonsense transcripts homolog B (yeast) antibody, UPF3B antibody, Upf3b antibody

Background: UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions.

Molecular Weight: 52 kDa (MW of target protein)