Trnt1 antibody (N-Term)
-
- Target See all Trnt1 Antibodies
- Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Trnt1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- TRNT1 antibody was raised against the N terminal of TRNT1
- Purification
- Purified
- Immunogen
- TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
- Top Product
- Discover our top product Trnt1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRNT1 Blocking Peptide, catalog no. 33R-7294, is also available for use as a blocking control in assays to test for specificity of this TRNT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRNT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))
- Alternative Name
- TRNT1 (Trnt1 Products)
- Background
- TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.
- Molecular Weight
- 45 kDa (MW of target protein)
-