Trnt1 antibody (N-Term)

Catalog No. ABIN629918

Product Details anti-Trnt1 Antibody

Target: Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Trnt1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: TRNT1 antibody was raised against the N terminal of TRNT1

Purification: Purified

Immunogen: TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRNT1 Blocking Peptide, catalog no. 33R-7294, is also available for use as a blocking control in assays to test for specificity of this TRNT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Trnt1

Target: Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))

Alternative Name: TRNT1 (Trnt1 Products)

Synonyms: bMtCCA antibody, zgc:86645 antibody, cca1 antibody, mtcca antibody, cgi-47 antibody, TRNT1 antibody, CCA1 antibody, MtCCA antibody, 2410043H24Rik antibody, 2610044E04Rik antibody, 9830143O18Rik antibody, AA408384 antibody, C76540 antibody, CGI-47 antibody, mt-Trat antibody, tRNA nucleotidyl transferase 1 antibody, tRNA nucleotidyl transferase, CCA-adding, 1 antibody, tRNA nucleotidyl transferase, CCA-adding, 1 L homeolog antibody, TRNT1 antibody, trnt1 antibody, trnt1.L antibody, Trnt1 antibody

Background: TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.

Molecular Weight: 45 kDa (MW of target protein)