RPP29 antibody

Catalog No. ABIN629915

Product Details anti-RPP29 Antibody

Target: RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPP29 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: POP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POP4 Blocking Peptide, catalog no. 33R-2327, is also available for use as a blocking control in assays to test for specificity of this POP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPP29

Target: RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))

Alternative Name: POP4 (POP4 Products)

Synonyms: POP4 antibody, RPP29 antibody, 1110023P21Rik antibody, Rpp29 antibody, zgc:110597 antibody, rpp29 antibody, POP4 homolog, ribonuclease P/MRP subunit antibody, processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae) antibody, POP4 homolog, ribonuclease P/MRP subunit L homeolog antibody, POP4 antibody, Pop4 antibody, pop4 antibody, pop4.L antibody

Background: POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.

Molecular Weight: 24 kDa (MW of target protein)