RPP29 antibody
-
- Target See all RPP29 (POP4) Antibodies
- RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPP29 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- POP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL
- Top Product
- Discover our top product POP4 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
POP4 Blocking Peptide, catalog no. 33R-2327, is also available for use as a blocking control in assays to test for specificity of this POP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POP4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))
- Alternative Name
- POP4 (POP4 Products)
- Background
- POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.
- Molecular Weight
- 24 kDa (MW of target protein)
-