ISG20 antibody (N-Term)

Catalog No. ABIN629913

Product Details anti-ISG20 Antibody

Target: ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ISG20 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ISG20 antibody was raised against the N terminal of ISG20

Purification: Purified

Immunogen: ISG20 antibody was raised using the N terminal of ISG20 corresponding to a region with amino acids GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ISG20 Blocking Peptide, catalog no. 33R-3179, is also available for use as a blocking control in assays to test for specificity of this ISG20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISG20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ISG20

Target: ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))

Alternative Name: ISG20 (ISG20 Products)

Synonyms: ISG20 antibody, CD25 antibody, HEM45 antibody, 1600023I01Rik antibody, 2010107M23Rik antibody, 20kDa antibody, DnaQL antibody, interferon stimulated exonuclease gene 20 antibody, interferon-stimulated protein antibody, ISG20 antibody, Isg20 antibody

Background: ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.

Molecular Weight: 20 kDa (MW of target protein)