EXOSC7 antibody (N-Term)
-
- Target See all EXOSC7 Antibodies
- EXOSC7 (Exosome Component 7 (EXOSC7))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EXOSC7 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- EXOSC7 antibody was raised against the N terminal of EXOSC7
- Purification
- Purified
- Immunogen
- EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD
- Top Product
- Discover our top product EXOSC7 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EXOSC7 Blocking Peptide, catalog no. 33R-4910, is also available for use as a blocking control in assays to test for specificity of this EXOSC7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOSC7 (Exosome Component 7 (EXOSC7))
- Alternative Name
- EXOSC7 (EXOSC7 Products)
- Background
- EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
- Molecular Weight
- 32 kDa (MW of target protein)
-