EXOSC7 antibody (N-Term)

Catalog No. ABIN629910

Product Details anti-EXOSC7 Antibody

Target: EXOSC7 (Exosome Component 7 (EXOSC7))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOSC7 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: EXOSC7 antibody was raised against the N terminal of EXOSC7

Purification: Purified

Immunogen: EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOSC7 Blocking Peptide, catalog no. 33R-4910, is also available for use as a blocking control in assays to test for specificity of this EXOSC7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOSC7

Target: EXOSC7 (Exosome Component 7 (EXOSC7))

Alternative Name: EXOSC7 (EXOSC7 Products)

Synonyms: EXOSC7 antibody, zgc:110717 antibody, EAP1 antibody, RRP42 antibody, Rrp42p antibody, hRrp42p antibody, p8 antibody, 2610002K22Rik antibody, AV212732 antibody, mKIAA0116 antibody, exosome component 7 antibody, exosome component 7 S homeolog antibody, exosc7 antibody, EXOSC7 antibody, exosc7.S antibody, Exosc7 antibody

Background: EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.

Molecular Weight: 32 kDa (MW of target protein)