SF3B1 antibody (N-Term)

Catalog No. ABIN629906

Product Details anti-SF3B1 Antibody

Target: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SF3B1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SF3 B1 antibody was raised against the N terminal of SF3 1

Purification: Purified

Immunogen: SF3 B1 antibody was raised using the N terminal of SF3 1 corresponding to a region with amino acids MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF3B1 Blocking Peptide, catalog no. 33R-5678, is also available for use as a blocking control in assays to test for specificity of this SF3B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SF3B1

Target: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Alternative Name: SF3B1 (SF3B1 Products)

Background: SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

Molecular Weight: 143 kDa (MW of target protein)

Pathways: Chromatin Binding