SF3B1 antibody (N-Term)

Catalog No. ABIN629906

Product Details anti-SF3B1 Antibody

Target: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SF3B1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SF3 B1 antibody was raised against the N terminal of SF3 1

Purification: Purified

Immunogen: SF3 B1 antibody was raised using the N terminal of SF3 1 corresponding to a region with amino acids MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF3B1 Blocking Peptide, catalog no. 33R-5678, is also available for use as a blocking control in assays to test for specificity of this SF3B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SF3B1

Target: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Alternative Name: SF3B1 (SF3B1 Products)

Synonyms: Cus1 antibody, SAP145 antibody, SF3B145 antibody, SF3b1 antibody, SF3b150 antibody, Hsh155 antibody, MDS antibody, PRP10 antibody, PRPF10 antibody, SAP155 antibody, SF3b155 antibody, 155kDa antibody, 2810001M05Rik antibody, AA409119 antibody, Prp10 antibody, TA-8 antibody, Targ4 antibody, hsh155 antibody, prp10 antibody, prpf10 antibody, sap155 antibody, SF3B1 antibody, Sap155 antibody, wu:fb99f09 antibody, splicing factor 3b subunit 2 antibody, splicing factor 3b subunit 1 antibody, splicing factor 3b, subunit 1 antibody, splicing factor 3b subunit 1 S homeolog antibody, SF3B2 antibody, SF3B1 antibody, Sf3b1 antibody, sf3b1.S antibody, sf3b1 antibody

Background: SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

Molecular Weight: 143 kDa (MW of target protein)

Pathways: Chromatin Binding