HNRNPL antibody (N-Term)
-
- Target See all HNRNPL Antibodies
- HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPL antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- HNRPL antibody was raised against the N terminal of HNRPL
- Purification
- Purified
- Immunogen
- HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD
- Top Product
- Discover our top product HNRNPL Primary Antibody
-
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (AA 282-589) antibody
HNRNPL Reactivity: Human WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (N-Term) antibodyHNRNPL Reactivity: Human, Mouse, Rat, Dog, Cow, Guinea Pig, Rabbit, Horse WB, IHC, IF, IP Host: Rabbit Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (N-Term) antibodyHNRNPL Reactivity: Human, Mouse WB, IHC, ELISA, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (AA 249-277) antibodyHNRNPL Reactivity: Human WB, IHC (p), FACS Host: Rabbit Polyclonal RB20811 unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (AA 1-558) antibodyHNRNPL Reactivity: Human WB, IF Host: Mouse Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) antibodyHNRNPL Reactivity: Human, Mouse, Xenopus laevis WB, ELISA, IF, IHC (p), IP, ICC Host: Mouse Monoclonal 1G11 unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) antibodyHNRNPL Reactivity: Human, Mouse, Rat, Newt WB, ELISA, IF, IHC (p), IP, FACS, ICC, IHC (fro) Host: Mouse Monoclonal 4D11 unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (N-Term) antibodyHNRNPL Reactivity: Human WB, IHC, ELISA, IF Host: Rabbit Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (AA 89-335) antibodyHNRNPL Reactivity: Human IHC, ELISA, IF Host: Rabbit Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (AA 461-490), (C-Term) antibodyHNRNPL Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB20812 unconjugated
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRPL Blocking Peptide, catalog no. 33R-2211, is also available for use as a blocking control in assays to test for specificity of this HNRPL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))
- Alternative Name
- HNRPL (HNRNPL Products)
- Synonyms
- HNRPL antibody, hnRNP-L antibody, zgc:55429 antibody, HNRNPL antibody, hnrpl antibody, C79783 antibody, D830027H13Rik antibody, Hnrpl antibody, hnrnp-L antibody, heterogeneous nuclear ribonucleoprotein L antibody, HNRNPL antibody, hnrpl antibody, hnrnpl antibody, Hnrnpl antibody
- Background
- Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA.
- Molecular Weight
- 65 kDa (MW of target protein)
-
