THO Complex 4 antibody (N-Term)

Catalog No. ABIN629900

Product Details anti-THO Complex 4 Antibody

Target: THO Complex 4 (THOC4)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This THO Complex 4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: THOC4 antibody was raised against the N terminal of THOC4

Purification: Purified

Immunogen: THOC4 antibody was raised using the N terminal of THOC4 corresponding to a region with amino acids GGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGA

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

THOC4 Blocking Peptide, catalog no. 33R-3282, is also available for use as a blocking control in assays to test for specificity of this THOC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for THO Complex 4

Target: THO Complex 4 (THOC4)

Alternative Name: THOC4 (THOC4 Products)

Synonyms: THOC4 antibody, Aly antibody, ALY antibody, ALY/REF antibody, BEF antibody, REF antibody, tho4 antibody, thoc4 antibody, zgc:171753 antibody, Tho4-A antibody, alyref-a antibody, thoc4-a antibody, REF1 antibody, Refbp1 antibody, Thoc4 antibody, Tho4 antibody, Aly/REF export factor antibody, THO complex 4 antibody, Aly/REF export factor L homeolog antibody, ALYREF antibody, Thoc4 antibody, alyref antibody, alyref.L antibody, Alyref antibody

Background: THOC4 is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.

Molecular Weight: 28 kDa (MW of target protein)