HNRNPH3 antibody
-
- Target See all HNRNPH3 Antibodies
- HNRNPH3 (Heterogeneous Nuclear Ribonucleoprotein H3 (2H9) (HNRNPH3))
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPH3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- HNRPH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY
- Top Product
- Discover our top product HNRNPH3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRPH3 Blocking Peptide, catalog no. 33R-2244, is also available for use as a blocking control in assays to test for specificity of this HNRPH3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPH3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPH3 (Heterogeneous Nuclear Ribonucleoprotein H3 (2H9) (HNRNPH3))
- Alternative Name
- HNRPH3 (HNRNPH3 Products)
- Background
- HNRPH3 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.
- Molecular Weight
- 38 kDa (MW of target protein)
-