SURF6 antibody (Middle Region)

Catalog No. ABIN629898

Product Details anti-SURF6 Antibody

Target: SURF6 (Surfeit 6 (SURF6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SURF6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SURF6 antibody was raised against the middle region of SURF6

Purification: Purified

Immunogen: SURF6 antibody was raised using the middle region of SURF6 corresponding to a region with amino acids EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SURF6 Blocking Peptide, catalog no. 33R-2644, is also available for use as a blocking control in assays to test for specificity of this SURF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SURF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SURF6

Target: SURF6 (Surfeit 6 (SURF6))

Alternative Name: SURF6 (SURF6 Products)

Synonyms: RRP14 antibody, CG4510 antibody, Dmel\\CG4510 antibody, SURF6 antibody, surf6 antibody, MGC79828 antibody, D2Wsu129e antibody, Surf-6 antibody, surf6l antibody, zgc:64008 antibody, surfeit 6 antibody, Surfeit 6 antibody, surfeit locus protein 6 pseudogene antibody, surfeit locus protein 6-like antibody, surfeit gene 6 antibody, surfeit 6 L homeolog antibody, SURF6 antibody, Surf6 antibody, LOC485740 antibody, surf6 antibody, LOC100222495 antibody, surf6.L antibody

Background: This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly