HNRPDL antibody (Middle Region)

Catalog No. ABIN629895

Product Details anti-HNRPDL Antibody

Target: HNRPDL (Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRPDL antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: HNRPDL antibody was raised against the middle region of HNRPDL

Purification: Purified

Immunogen: HNRPDL antibody was raised using the middle region of HNRPDL corresponding to a region with amino acids TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPDL Blocking Peptide, catalog no. 33R-9199, is also available for use as a blocking control in assays to test for specificity of this HNRPDL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPDL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRPDL

Target: HNRPDL (Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL))

Alternative Name: HNRPDL (HNRPDL Products)

Synonyms: wu:fa11d08 antibody, zgc:66169 antibody, hnRNP DL antibody, Hnrpdl antibody, AA407431 antibody, AA959857 antibody, D5Ertd650e antibody, D5Wsu145e antibody, JKTBP antibody, hnRNP-DL antibody, hnRNP antibody, hnrpdl antibody, hnrpdl-a antibody, jktbp antibody, jktbp2 antibody, laauf1 antibody, HNRNP antibody, HNRPDL antibody, JKTBP2 antibody, laAUF1 antibody, hnRNP D-like B antibody, hnRNP DL-B antibody, hnrnpdl-b antibody, hnrpdl-b antibody, heterogeneous nuclear ribonucleoprotein D-like antibody, heterogeneous nuclear ribonucleoprotein D like antibody, heterogeneous nuclear ribonucleoprotein D like L homeolog antibody, heterogeneous nuclear ribonucleoprotein D like S homeolog antibody, hnrpdl antibody, HNRNPDL antibody, Hnrnpdl antibody, hnrnpdl.L antibody, LOC100351670 antibody, LOC101120922 antibody, hnrnpdl.S antibody

Background: HNRPDL belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPDL has two RRM domains that bind to RNAs.

Molecular Weight: 40 kDa (MW of target protein)