HNRNPK antibody (C-Term)
-
- Target See all HNRNPK Antibodies
- HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPK antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- HNRPK antibody was raised against the C terminal of HNRPK
- Purification
- Purified
- Immunogen
- HNRPK antibody was raised using the C terminal of HNRPK corresponding to a region with amino acids YSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
- Top Product
- Discover our top product HNRNPK Primary Antibody
-
anti-Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK) (AA 1-280) antibody
HNRNPK Reactivity: Human WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK) antibodyHNRNPK Reactivity: Human WB, IF, IHC (p), ICC Host: Rabbit Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK) antibodyHNRNPK Reactivity: Human WB, IHC, ELISA, IF, IP Host: Rabbit Monoclonal 3G7 unconjugated Recombinant Antibody
anti-Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK) (AA 1-463) antibodyHNRNPK Reactivity: Human WB, IF Host: Mouse Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK) antibodyHNRNPK Reactivity: Human, Mouse, Rat, Cow, Xenopus laevis, Hamster WB, IHC, ELISA, IF, IP, ICC, FACS, ChIP Host: Mouse Monoclonal 3C2 unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK) (pSer284) antibodyHNRNPK Reactivity: Human, Mouse WB, ELISA, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK) antibodyHNRNPK Reactivity: Human, Mouse, Rat, Rabbit, Chicken, Dog, Goat, Horse, Monkey WB, IHC, IHC (p) Host: Mouse Monoclonal F45 P9 C7 unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK) (AA 371-420) antibodyHNRNPK Reactivity: Human, Mouse, Rat, Cow, Rabbit, Chicken, Dog, Zebrafish (Danio rerio), Guinea Pig, Goat, Horse, Monkey, Xenopus laevis, Pig, Bat WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK) (N-Term) antibodyHNRNPK Reactivity: Human, Mouse, Rat, Cow, Rabbit, Chicken, Dog, Guinea Pig, Goat, Horse, Monkey, Xenopus laevis, Bat WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK) (N-Term) antibodyHNRNPK Reactivity: Human, Mouse, Rat, Dog WB, IHC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRPK Blocking Peptide, catalog no. 33R-10254, is also available for use as a blocking control in assays to test for specificity of this HNRPK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))
- Alternative Name
- HNRPK (HNRNPK Products)
- Background
- HNRPK belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.
- Molecular Weight
- 51 kDa (MW of target protein)
-
