HNRNPK antibody (C-Term)

Catalog No. ABIN629892

Product Details anti-HNRNPK Antibody

Target: HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPK antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: HNRPK antibody was raised against the C terminal of HNRPK

Purification: Purified

Immunogen: HNRPK antibody was raised using the C terminal of HNRPK corresponding to a region with amino acids YSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPK Blocking Peptide, catalog no. 33R-10254, is also available for use as a blocking control in assays to test for specificity of this HNRPK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPK

Target: HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))

Alternative Name: HNRPK (HNRNPK Products)

Synonyms: CSBP antibody, HNRPK antibody, TUNP antibody, Csbp antibody, Hnrpk antibody, hnrpk antibody, MGC75642 antibody, wu:fb37h02 antibody, wu:fi34c04 antibody, zgc:66162 antibody, KBBP antibody, NOVA antibody, heterogeneous nuclear ribonucleoprotein K antibody, heterogeneous nuclear ribonucleoprotein K S homeolog antibody, heterogeneous nuclear ribonucleoprotein k antibody, HNRNPK antibody, Hnrnpk antibody, hnrnpk.S antibody, hnrnpk antibody, LOC5565718 antibody, CpipJ_CPIJ000130 antibody, NGK_p0004 antibody

Background: HNRPK belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molecular Weight: 51 kDa (MW of target protein)