PPP1R8 antibody

Catalog No. ABIN629887

Product Details anti-PPP1R8 Antibody

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP1R8 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: PPP1 R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP1R8 Blocking Peptide, catalog no. 33R-7235, is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP1R8

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Alternative Name: PPP1R8 (PPP1R8 Products)

Synonyms: ARD-1 antibody, ARD1 antibody, NIPP-1 antibody, NIPP1 antibody, PRO2047 antibody, 6330548N22Rik antibody, AU044684 antibody, PPP1R8 antibody, ard-1 antibody, ard1 antibody, nipp-1 antibody, nipp1 antibody, ppp1r8 antibody, si:ch211-206a7.1 antibody, protein phosphatase 1 regulatory subunit 8 antibody, protein phosphatase 1, regulatory subunit 8 antibody, protein phosphatase 1, regulatory (inhibitor) subunit 8 antibody, protein phosphatase 1, regulatory subunit 8b antibody, protein phosphatase 1 regulatory subunit 8 L homeolog antibody, protein phosphatase 1, regulatory subunit 8a antibody, protein phosphatase 1 regulatory subunit 8 S homeolog antibody, PPP1R8 antibody, Ppp1r8 antibody, ppp1r8b antibody, ppp1r8.L antibody, ppp1r8a antibody, ppp1r8.S antibody

Background: This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Molecular Weight: 14 kDa (MW of target protein)