HNRNPA1 antibody (N-Term)

Catalog No. ABIN629885

Product Details anti-HNRNPA1 Antibody

Target: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: HNRPA1 antibody was raised against the N terminal of HNRPA1

Purification: Purified

Immunogen: HNRPA1 antibody was raised using the N terminal of HNRPA1 corresponding to a region with amino acids MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPA1 Blocking Peptide, catalog no. 33R-6455, is also available for use as a blocking control in assays to test for specificity of this HNRPA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPA1

Target: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Alternative Name: HNRPA1 (HNRNPA1 Products)

Synonyms: HNRPA1 antibody, HNRPA1L3 antibody, hnRNP A1 antibody, hnRNP-A1 antibody, hnrpa1 antibody, TPT1P antibody, HNRNPA1 antibody, D15Ertd119e antibody, Hdp antibody, Hnrpa1 antibody, hnrnp-A1 antibody, ROA1 antibody, zgc:66127 antibody, heterogeneous nuclear ribonucleoprotein A1 antibody, heterogeneous nuclear ribonucleoprotein A1b antibody, Heterogeneous nuclear ribonucleoprotein A1 antibody, heterogeneous nuclear ribonucleoprotein A1 S homeolog antibody, ribonucleoprotein A1a antibody, heterogeneous nuclear ribonucleoprotein A1-like antibody, heterogeneous nuclear ribonucleoprotein A1a antibody, HNRNPA1 antibody, hnrnpa1b antibody, LOC100101226 antibody, roa1 antibody, Hnrnpa1 antibody, hnrnpa1.S antibody, hnrnpa1 antibody, LOC100359118 antibody, hnrnpa1a antibody

Background: HNRPA1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). HNRPA1 has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. HNRPA1 is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition.

Molecular Weight: 35 kDa (MW of target protein)