HNRNPA1 antibody (N-Term)
-
- Target See all HNRNPA1 Antibodies
- HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPA1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- HNRPA1 antibody was raised against the N terminal of HNRPA1
- Purification
- Purified
- Immunogen
- HNRPA1 antibody was raised using the N terminal of HNRPA1 corresponding to a region with amino acids MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
- Top Product
- Discover our top product HNRNPA1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRPA1 Blocking Peptide, catalog no. 33R-6455, is also available for use as a blocking control in assays to test for specificity of this HNRPA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))
- Alternative Name
- HNRPA1 (HNRNPA1 Products)
- Background
- HNRPA1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). HNRPA1 has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. HNRPA1 is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition.
- Molecular Weight
- 35 kDa (MW of target protein)
-