DDX49 antibody

Catalog No. ABIN629881

Product Details anti-DDX49 Antibody

Target: DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))

Reactivity: Human, Dog, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX49 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX49 Blocking Peptide, catalog no. 33R-2530, is also available for use as a blocking control in assays to test for specificity of this DDX49 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX49 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX49

Target: DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))

Alternative Name: DDX49 (DDX49 Products)

Synonyms: MGC76291 antibody, r27090_2 antibody, DDX49 antibody, wu:fb82g04 antibody, wu:fd12e05 antibody, ddx49-a antibody, R27090_2 antibody, DEAD-box helicase 49 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 antibody, DEAD-box helicase 49 S homeolog antibody, ddx49 antibody, DDX49 antibody, ddx49.S antibody, Ddx49 antibody

Background: The function of Anti-DDX49 has not yet been determined.

Molecular Weight: 53 kDa (MW of target protein)