TMEM108 antibody (Middle Region)

Catalog No. ABIN629878

Product Details anti-TMEM108 Antibody

Target: TMEM108 (Transmembrane Protein 108 (TMEM108))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM108 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM108 antibody was raised against the middle region of TMEM108

Purification: Purified

Immunogen: TMEM108 antibody was raised using the middle region of TMEM108 corresponding to a region with amino acids NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM108 Blocking Peptide, catalog no. 33R-6859, is also available for use as a blocking control in assays to test for specificity of this TMEM108 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM108 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM108

Target: TMEM108 (Transmembrane Protein 108 (TMEM108))

Alternative Name: TMEM108 (TMEM108 Products)

Synonyms: TMEM108 antibody, CT124 antibody, AI462967 antibody, B130017P16Rik antibody, R74726 antibody, RGD1311530 antibody, transmembrane protein 108 antibody, TMEM108 antibody, Tmem108 antibody

Background: TMEM108's function has not been determined yet.

Molecular Weight: 54 kDa (MW of target protein)