CHD1L antibody (Middle Region)
-
- Target See all CHD1L Antibodies
- CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHD1L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CHD1 L antibody was raised against the middle region of CHD1
- Purification
- Purified
- Immunogen
- CHD1 L antibody was raised using the middle region of CHD1 corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL
- Top Product
- Discover our top product CHD1L Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHD1L Blocking Peptide, catalog no. 33R-1859, is also available for use as a blocking control in assays to test for specificity of this CHD1L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHD0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))
- Alternative Name
- CHD1L (CHD1L Products)
- Background
- CHD1L encodes a protein that interacts with ADP-ribose. ADP-ribosylation of proteins is an important post-translational modification that occurs in a variety of biological processes, including DNA repair, transcription, chromatin biology and long-term memory formation.
- Molecular Weight
- 45 kDa (MW of target protein)
-