CHD1L antibody (Middle Region)

Catalog No. ABIN629877

Product Details anti-CHD1L Antibody

Target: CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHD1L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CHD1 L antibody was raised against the middle region of CHD1

Purification: Purified

Immunogen: CHD1 L antibody was raised using the middle region of CHD1 corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHD1L Blocking Peptide, catalog no. 33R-1859, is also available for use as a blocking control in assays to test for specificity of this CHD1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHD1L

Target: CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))

Alternative Name: CHD1L (CHD1L Products)

Synonyms: CHD1L antibody, ALC1 antibody, CHDL antibody, 4432404A22Rik antibody, Alc1 antibody, Snf2p antibody, zgc:56084 antibody, chromodomain helicase DNA binding protein 1 like antibody, chromodomain helicase DNA binding protein 1-like antibody, CHD1L antibody, chd1l antibody, Chd1l antibody

Background: CHD1L encodes a protein that interacts with ADP-ribose. ADP-ribosylation of proteins is an important post-translational modification that occurs in a variety of biological processes, including DNA repair, transcription, chromatin biology and long-term memory formation.

Molecular Weight: 45 kDa (MW of target protein)