BRK1 antibody (Middle Region)

Catalog No. ABIN629872

Product Details anti-BRK1 Antibody

Target: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BRK1 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificity: C3 ORF10 antibody was raised against the middle region of C3 rf10

Purification: Purified

Immunogen: C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C3ORF10 Blocking Peptide, catalog no. 33R-10134, is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BRK1

Target: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Alternative Name: C3ORF10 (BRK1 Products)

Synonyms: brk1 antibody, C22H3orf10 antibody, brick1 antibody, c3orf10 antibody, C3orf10 antibody, MDS027 antibody, hHBrk1 antibody, 6720456B07Rik antibody, AW011779 antibody, ATBRK1 antibody, BRICK1 antibody, HSPC300 antibody, T9I22.8 antibody, T9I22_8 antibody, BRICK1, SCAR/WAVE actin-nucleating complex subunit antibody, BRICK1, SCAR/WAVE actin nucleating complex subunit antibody, brick 1 antibody, BRICK1, SCAR/WAVE actin-nucleating complex subunit S homeolog antibody, BRICK1 antibody, brk1 antibody, BRK1 antibody, Brk1 antibody, brk1.S antibody

Background: C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.

Molecular Weight: 9 kDa (MW of target protein)

Pathways: RTK Signaling