BRK1 antibody (Middle Region)
-
- Target See all BRK1 Antibodies
- BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BRK1 antibody is un-conjugated
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Specificity
- C3 ORF10 antibody was raised against the middle region of C3 rf10
- Purification
- Purified
- Immunogen
- C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
- Top Product
- Discover our top product BRK1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C3ORF10 Blocking Peptide, catalog no. 33R-10134, is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))
- Alternative Name
- C3ORF10 (BRK1 Products)
- Background
- C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
- Molecular Weight
- 9 kDa (MW of target protein)
- Pathways
- RTK Signaling
-