GGTLC1 antibody (C-Term)

Catalog No. ABIN629871

Product Details anti-GGTLC1 Antibody

Target: GGTLC1 (gamma-Glutamyltransferase Light Chain 1 (GGTLC1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GGTLC1 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificity: GGTLA4 antibody was raised against the C terminal of GGTLA4

Purification: Purified

Immunogen: GGTLA4 antibody was raised using the C terminal of GGTLA4 corresponding to a region with amino acids DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GGTLA4 Blocking Peptide, catalog no. 33R-2128, is also available for use as a blocking control in assays to test for specificity of this GGTLA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGTLA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GGTLC1

Target: GGTLC1 (gamma-Glutamyltransferase Light Chain 1 (GGTLC1))

Alternative Name: GGTLA4 (GGTLC1 Products)

Synonyms: GGTL6 antibody, GGTLA3 antibody, GGTLA4 antibody, dJ831C21.1 antibody, dJ831C21.2 antibody, gamma-glutamyltransferase light chain 1 antibody, GGTLC1 antibody

Background: Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein is similar in sequence to several members of the gamma-glutamyl transpeptidase family.Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione.

Molecular Weight: 25 kDa (MW of target protein)