PLIN1 antibody (N-Term)

Catalog No. ABIN629870

Product Details anti-PLIN1 Antibody

Target: PLIN1 (Perilipin 1 (PLIN1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLIN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Perilipin antibody was raised against the N terminal of PLIN

Purification: Purified

Immunogen: Perilipin antibody was raised using the N terminal of PLIN corresponding to a region with amino acids STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Perilipin Blocking Peptide, catalog no. 33R-8885, is also available for use as a blocking control in assays to test for specificity of this Perilipin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-PLIN1 antibody (ABIN629870)

Rudolph, Jackman, Presby, Houck, Webb, Johnson, Soderborg, de la Houssaye, Yang, Friedman, MacLean: "Low Neonatal Plasma n-6/n-3 PUFA Ratios Regulate Offspring Adipogenic Potential and Condition Adult Obesity Resistance." in: Diabetes, Vol. 67, Issue 4, pp. 651-661, (2018) (PubMed).

Target Details for PLIN1

Target: PLIN1 (Perilipin 1 (PLIN1))

Alternative Name: Perilipin (PLIN1 Products)

Synonyms: FPLD4 antibody, PERI antibody, PLIN antibody, PERIA antibody, Plin antibody, 6030432J05Rik antibody, Peri antibody, peri antibody, plin antibody, perilipin antibody, LOC692833 antibody, perilipin 1 antibody, perilipin antibody, perilipin 1 L homeolog antibody, PLIN1 antibody, Plin1 antibody, plin1 antibody, LOC692833 antibody, plin1.L antibody

Background: PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Lipid Metabolism