DDC antibody

Catalog No. ABIN629869

Product Details anti-DDC Antibody

Target: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDC antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDC Blocking Peptide, catalog no. 33R-2411, is also available for use as a blocking control in assays to test for specificity of this DDC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDC

Target: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Alternative Name: DDC (DDC Products)

Synonyms: AADC antibody, wu:fa56d05 antibody, wu:fd59h03 antibody, wu:fk20h01 antibody, zgc:65801 antibody, zgc:76929 antibody, Ddc antibody, DdcDv antibody, Dvir\\GJ17995 antibody, GJ17995 antibody, dvir_GLEANR_2561 antibody, Aadc antibody, 5-HT antibody, CG10697 antibody, DDC antibody, DdcDm antibody, Dmel\\CG10697 antibody, ddc antibody, fDDC antibody, l(2)37Bl antibody, l(2)37Ch antibody, l(2)k02104 antibody, dopa decarboxylase antibody, Dopa-decarboxylase antibody, dopa decarboxylase (aromatic L-amino acid decarboxylase) antibody, Dopa decarboxylase antibody, dopa decarboxylase L homeolog antibody, DDC antibody, ddc antibody, Ddc antibody, Dvir\Ddc antibody, ddc.L antibody

Background: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis