Niban antibody (N-Term)

Catalog No. ABIN629867

Product Details anti-Niban Antibody

Target: Niban (FAM129A) (Family with Sequence Similarity 129, Member A (FAM129A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Niban antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM129 A antibody was raised against the N terminal of FAM129

Purification: Purified

Immunogen: FAM129 A antibody was raised using the N terminal of FAM129 corresponding to a region with amino acids SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM129A Blocking Peptide, catalog no. 33R-8947, is also available for use as a blocking control in assays to test for specificity of this FAM129A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Niban

Target: Niban (FAM129A) (Family with Sequence Similarity 129, Member A (FAM129A))

Alternative Name: FAM129A (FAM129A Products)

Synonyms: C1orf24 antibody, NIBAN antibody, AI256368 antibody, AU019833 antibody, Niban antibody, family with sequence similarity 129 member A antibody, family with sequence similarity 129, member A antibody, FAM129A antibody, Fam129a antibody

Background: FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker.

Molecular Weight: 103 kDa (MW of target protein)