LZTFL1 antibody (C-Term)
-
- Target See all LZTFL1 Antibodies
- LZTFL1 (Leucine Zipper Transcription Factor-Like 1 (LZTFL1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LZTFL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LZTFL1 antibody was raised against the C terminal of LZTFL1
- Purification
- Purified
- Immunogen
- LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
- Top Product
- Discover our top product LZTFL1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LZTFL1 Blocking Peptide, catalog no. 33R-9745, is also available for use as a blocking control in assays to test for specificity of this LZTFL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTFL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LZTFL1 (Leucine Zipper Transcription Factor-Like 1 (LZTFL1))
- Alternative Name
- LZTFL1 (LZTFL1 Products)
- Synonyms
- lztfl1 antibody, MGC53120 antibody, LZTFL1 antibody, DKFZp469B0113 antibody, fb53f12 antibody, wu:fb53f12 antibody, zgc:56268 antibody, BBS17 antibody, 5530402H04Rik antibody, 6130400H19Rik antibody, AI414725 antibody, AW048545 antibody, leucine zipper transcription factor like 1 L homeolog antibody, leucine zipper transcription factor like 1 antibody, leucine zipper transcription factor-like 1 antibody, lztfl1.L antibody, LZTFL1 antibody, lztfl1 antibody, Lztfl1 antibody
- Background
- LZTFL1 may be involved in vesicle-mediated transport.
- Molecular Weight
- 34 kDa (MW of target protein)
-