IFI44L antibody (N-Term)
-
- Target See all IFI44L Antibodies
- IFI44L (Interferon-Induced Protein 44-Like (IFI44L))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IFI44L antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- IFI44 L antibody was raised against the N terminal of IFI44
- Purification
- Purified
- Immunogen
- IFI44 L antibody was raised using the N terminal of IFI44 corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IFI44L Blocking Peptide, catalog no. 33R-5983, is also available for use as a blocking control in assays to test for specificity of this IFI44L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI40 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFI44L (Interferon-Induced Protein 44-Like (IFI44L))
- Alternative Name
- IFI44L (IFI44L Products)
- Background
- The function of this gene remains unknown.
- Molecular Weight
- 47 kDa (MW of target protein)
-