SHMT2 antibody
-
- Target See all SHMT2 Antibodies
- SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SHMT2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR
- Top Product
- Discover our top product SHMT2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SHMT2 Blocking Peptide, catalog no. 33R-2550, is also available for use as a blocking control in assays to test for specificity of this SHMT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHMT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))
- Alternative Name
- SHMT2 (SHMT2 Products)
- Background
- SHMT2 plays a role in interconversion of serine and glycine.
- Molecular Weight
- 56 kDa (MW of target protein)
-