SHMT2 antibody

Catalog No. ABIN629860

Product Details anti-SHMT2 Antibody

Target: SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SHMT2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SHMT2 Blocking Peptide, catalog no. 33R-2550, is also available for use as a blocking control in assays to test for specificity of this SHMT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SHMT2

Target: SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))

Alternative Name: SHMT2 (SHMT2 Products)

Synonyms: GLYA antibody, SHMT antibody, 2700043D08Rik antibody, AA408223 antibody, AA986903 antibody, serine hydroxymethyltransferase 2 antibody, serine hydroxymethyltransferase 2 (mitochondrial) antibody, serine hydroxymethyltransferase 2 (mitochondrial) L homeolog antibody, serine hydroxymethyltransferase, mitochondrial-like antibody, SHMT2 antibody, Chro.80302 antibody, Shmt2 antibody, shmt2 antibody, shmt2.L antibody, SHMT antibody

Background: SHMT2 plays a role in interconversion of serine and glycine.

Molecular Weight: 56 kDa (MW of target protein)