MORF4L1 antibody (Middle Region)
-
- Target See all MORF4L1 Antibodies
- MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MORF4L1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- MORF4 L1 antibody was raised against the middle region of MORF4 1
- Purification
- Purified
- Immunogen
- MORF4 L1 antibody was raised using the middle region of MORF4 1 corresponding to a region with amino acids YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ
- Top Product
- Discover our top product MORF4L1 Primary Antibody
-
-
- Application Notes
-
WB: 5-10 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MORF4L1 Blocking Peptide, catalog no. 33R-10055, is also available for use as a blocking control in assays to test for specificity of this MORF4L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MORF0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))
- Alternative Name
- MORF4L1 (MORF4L1 Products)
- Background
- MORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-