FLJ14213 (N-Term) antibody

Catalog No. ABIN629854

Product Details

Target: FLJ14213

Binding Specificity: N-Term

Reactivity: Rat, Dog, Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: FLJ14213 antibody was raised against the N terminal of FLJ14213

Purification: Purified

Immunogen: FLJ14213 antibody was raised using the N terminal of FLJ14213 corresponding to a region with amino acids SAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQ

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ14213 Blocking Peptide, catalog no. 33R-8324, is also available for use as a blocking control in assays to test for specificity of this FLJ14213 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ14213 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: FLJ14213

Background: FLJ14213 may be part of the TORC2 complex which plays a critical role in AKT1 'Ser-473' phosphorylation, and may modulate the phosphorylation of PKCA and regulate actin cytoskeleton organization

Molecular Weight: 40 kDa (MW of target protein)