LRRC2 antibody (C-Term)

Catalog No. ABIN629853

Product Details anti-LRRC2 Antibody

Target: LRRC2 (Leucine Rich Repeat Containing 2 (LRRC2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC2 antibody was raised against the C terminal of LRRC2

Purification: Purified

Immunogen: LRRC2 antibody was raised using the C terminal of LRRC2 corresponding to a region with amino acids NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC2 Blocking Peptide, catalog no. 33R-6643, is also available for use as a blocking control in assays to test for specificity of this LRRC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC2

Target: LRRC2 (Leucine Rich Repeat Containing 2 (LRRC2))

Alternative Name: LRRC2 (LRRC2 Products)

Synonyms: 2400002D05Rik antibody, 4933431K03Rik antibody, leucine rich repeat containing 2 antibody, LRRC2 antibody, Lrrc2 antibody

Background: Leucine-rich repeats (LRRs) are 20-29 amino acid motifs that mediate proteinprotein interactions. The primary function of these motifs is to provide a versatile structural framework for the formation of these protein-protein interactions.

Molecular Weight: 43 kDa (MW of target protein)