PSG3 antibody (N-Term)

Catalog No. ABIN629852

Product Details anti-PSG3 Antibody

Target: PSG3 (Pregnancy Specific beta-1-Glycoprotein 3 (PSG3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSG3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PSG3 antibody was raised against the N terminal of PSG3

Purification: Purified

Immunogen: PSG3 antibody was raised using the N terminal of PSG3 corresponding to a region with amino acids VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSG3 Blocking Peptide, catalog no. 33R-9927, is also available for use as a blocking control in assays to test for specificity of this PSG3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSG3

Target: PSG3 (Pregnancy Specific beta-1-Glycoprotein 3 (PSG3))

Alternative Name: PSG3 (PSG3 Products)

Synonyms: PSG3 antibody, pregnancy specific beta-1-glycoprotein 3 antibody, pregnancy-specific beta-1-glycoprotein 3 antibody, PSG3 antibody, LOC741127 antibody

Background: The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes.

Molecular Weight: 16 kDa (MW of target protein)