AKR1B10 antibody
-
- Target See all AKR1B10 Antibodies
- AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AKR1B10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- AKR1 B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL
- Top Product
- Discover our top product AKR1B10 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AKR1B10 Blocking Peptide, catalog no. 33R-6669, is also available for use as a blocking control in assays to test for specificity of this AKR1B10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))
- Alternative Name
- AKR1B10 (AKR1B10 Products)
- Background
- AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
- Molecular Weight
- 35 kDa (MW of target protein)
-