AKR1B10 antibody

Catalog No. ABIN629851

Product Details anti-AKR1B10 Antibody

Target: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKR1B10 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: AKR1 B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKR1B10 Blocking Peptide, catalog no. 33R-6669, is also available for use as a blocking control in assays to test for specificity of this AKR1B10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKR1B10

Target: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Alternative Name: AKR1B10 (AKR1B10 Products)

Synonyms: AKR1B11 antibody, AKR1B12 antibody, ALDRLn antibody, ARL-1 antibody, ARL1 antibody, HIS antibody, HSI antibody, 2310005E10Rik antibody, Akr1b16 antibody, AKR antibody, AKR1B10 antibody, Akr1b10 antibody, aldo-keto reductase family 1 member B10 antibody, aldo-keto reductase family 1, member B10 (aldose reductase) antibody, aldo-keto reductase family 1 member B10-like 2 antibody, AKR1B10 antibody, Akr1b10 antibody, AKR1B10L2 antibody, LOC100585902 antibody, LOC100723118 antibody, LOC101107697 antibody

Background: AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Molecular Weight: 35 kDa (MW of target protein)