RBP1 antibody (Middle Region)

Catalog No. ABIN629847

Product Details anti-RBP1 Antibody

Target: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBP1 antibody was raised against the middle region of RBP1

Purification: Purified

Immunogen: RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBP1 Blocking Peptide, catalog no. 33R-4007, is also available for use as a blocking control in assays to test for specificity of this RBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBP1

Target: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Alternative Name: RBP1 (RBP1 Products)

Synonyms: RBBP-1 antibody, RBBP1 antibody, RBP-1 antibody, RBP1 antibody, CRABP-I antibody, CRBP antibody, CRBP1 antibody, CRBPI antibody, RBPC antibody, cb465 antibody, rbp1 antibody, wu:fb75e07 antibody, zgc:73335 antibody, CRABP1 antibody, Crbp antibody, Rbp-1 antibody, rbp1b antibody, sb:eu611 antibody, zgc:100825 antibody, AT-rich interaction domain 4A antibody, retinol binding protein 1 antibody, retinol binding protein 1a, cellular antibody, retinol binding protein 1 L homeolog antibody, retinol binding protein 1, cellular antibody, retinol binding protein 1b, cellular antibody, ARID4A antibody, RBP1 antibody, rbp5 antibody, rbp1.L antibody, rbp1 antibody, Rbp1 antibody

Background: RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.

Molecular Weight: 15 kDa (MW of target protein)