METTL13 antibody (C-Term)

Catalog No. ABIN629845

Product Details anti-METTL13 Antibody

Target: METTL13 (Methyltransferase Like 13 (METTL13))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA0859 antibody was raised against the C terminal of KIAA0859

Purification: Purified

Immunogen: KIAA0859 antibody was raised using the C terminal of KIAA0859 corresponding to a region with amino acids NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA0859 Blocking Peptide, catalog no. 33R-6670, is also available for use as a blocking control in assays to test for specificity of this KIAA0859 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0859 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METTL13

Target: METTL13 (Methyltransferase Like 13 (METTL13))

Alternative Name: KIAA0859 (METTL13 Products)

Synonyms: METTL13 antibody, KIAA0859 antibody, cgi-01 antibody, kiaa0859 antibody, RGD1311526 antibody, 5630401D24Rik antibody, feat antibody, si:dkey-19f21.2 antibody, zgc:152769 antibody, methyltransferase like 13 antibody, methyltransferase like 13 S homeolog antibody, METTL13 antibody, mettl13 antibody, Mettl13 antibody, mettl13.S antibody

Background: The function of KIAA0859 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 60 kDa (MW of target protein)