ABHD5 antibody (N-Term)
-
- Target See all ABHD5 Antibodies
- ABHD5 (Abhydrolase Domain Containing 5 (ABHD5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABHD5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ABHD5 antibody was raised against the N terminal of ABHD5
- Purification
- Purified
- Immunogen
- ABHD5 antibody was raised using the N terminal of ABHD5 corresponding to a region with amino acids NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL
- Top Product
- Discover our top product ABHD5 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABHD5 Blocking Peptide, catalog no. 33R-6861, is also available for use as a blocking control in assays to test for specificity of this ABHD5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABHD5 (Abhydrolase Domain Containing 5 (ABHD5))
- Alternative Name
- ABHD5 (ABHD5 Products)
- Background
- ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in ABHD5 gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-