ABHD5 antibody (N-Term)

Catalog No. ABIN629839

Product Details anti-ABHD5 Antibody

Target: ABHD5 (Abhydrolase Domain Containing 5 (ABHD5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABHD5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ABHD5 antibody was raised against the N terminal of ABHD5

Purification: Purified

Immunogen: ABHD5 antibody was raised using the N terminal of ABHD5 corresponding to a region with amino acids NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABHD5 Blocking Peptide, catalog no. 33R-6861, is also available for use as a blocking control in assays to test for specificity of this ABHD5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABHD5

Target: ABHD5 (Abhydrolase Domain Containing 5 (ABHD5))

Alternative Name: ABHD5 (ABHD5 Products)

Synonyms: ABHD5 antibody, cds antibody, cgi58 antibody, iecn2 antibody, ncie2 antibody, abhd5 antibody, CDS antibody, CGI58 antibody, IECN2 antibody, NCIE2 antibody, 1300003D03Rik antibody, 2010002J10Rik antibody, CGI-58 antibody, IECN5 antibody, abhydrolase domain containing 5 antibody, abhydrolase domain containing 5a antibody, abhydrolase domain containing 5 L homeolog antibody, ABHD5 antibody, abhd5 antibody, abhd5a antibody, Abhd5 antibody, abhd5.L antibody

Background: ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in ABHD5 gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Lipid Metabolism