NNMT antibody (N-Term)

Catalog No. ABIN629835

Product Details anti-NNMT Antibody

Target: NNMT (Nicotinamide N-Methyltransferase (NNMT))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NNMT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NNMT antibody was raised against the N terminal of NNMT

Purification: Purified

Immunogen: NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NNMT Blocking Peptide, catalog no. 33R-5957, is also available for use as a blocking control in assays to test for specificity of this NNMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NNMT

Target: NNMT (Nicotinamide N-Methyltransferase (NNMT))

Alternative Name: NNMT (NNMT Products)

Synonyms: MGC64498 antibody, Afu1g17750 antibody, AO090026000620 antibody, nnmt antibody, nicotinamide N-methyltransferase S homeolog antibody, nicotinamide N-methyltransferase antibody, nicotinamide n-methyltransferase antibody, Nicotinamide N-methyltransferase antibody, nnmt.S antibody, CNG02680 antibody, AFUA_1G17750 antibody, AOR_1_1132194 antibody, AOR_1_1124014 antibody, CC1G_02598 antibody, VDBG_08111 antibody, TERG_00572 antibody, Tsp_04293 antibody, nnmt antibody, NNMT antibody, Nnmt antibody

Background: N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver.

Molecular Weight: 29 kDa (MW of target protein)