RGS16 antibody (C-Term)

Catalog No. ABIN629833

Product Details anti-RGS16 Antibody

Target: RGS16 (Regulator of G-Protein Signaling 16 (RGS16))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RGS16 antibody was raised against the C terminal of RGS16

Purification: Purified

Immunogen: RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS16 Blocking Peptide, catalog no. 33R-1842, is also available for use as a blocking control in assays to test for specificity of this RGS16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS16

Target: RGS16 (Regulator of G-Protein Signaling 16 (RGS16))

Alternative Name: RGS16 (RGS16 Products)

Synonyms: A28-RGS14 antibody, A28-RGS14P antibody, RGS-R antibody, Rgs14 antibody, Rgsr antibody, XRGSI antibody, rgsI-A antibody, zgc:110164 antibody, rgs16 antibody, regulator of G protein signaling 16 antibody, regulator of G-protein signaling 16 antibody, regulator of G-protein signaling 16 L homeolog antibody, RGS16 antibody, Rgs16 antibody, rgs16.L antibody, rgs16 antibody

Background: RGS16 belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling