HSD17B6 antibody (N-Term)
-
- Target See all HSD17B6 Antibodies
- HSD17B6 (Hydroxysteroid (17-Beta) Dehydrogenase 6 (HSD17B6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HSD17B6 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- HSD17 B6 antibody was raised against the N terminal of HSD17 6
- Purification
- Purified
- Immunogen
- HSD17 B6 antibody was raised using the N terminal of HSD17 6 corresponding to a region with amino acids MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD
- Top Product
- Discover our top product HSD17B6 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HSD17B6 Blocking Peptide, catalog no. 33R-6617, is also available for use as a blocking control in assays to test for specificity of this HSD17B6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSD17B6 (Hydroxysteroid (17-Beta) Dehydrogenase 6 (HSD17B6))
- Alternative Name
- HSD17B6 (HSD17B6 Products)
- Synonyms
- HSE antibody, RODH antibody, SDR9C6 antibody, 17betaHSD9 antibody, Hsd17b9 antibody, Rdh8 antibody, hydroxysteroid 17-beta dehydrogenase 6 antibody, hydroxysteroid (17-beta) dehydrogenase 6 antibody, HSD17B6 antibody, Hsd17b6 antibody
- Background
- HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-