PRPS2 antibody (N-Term)

Catalog No. ABIN629828

Product Details anti-PRPS2 Antibody

Target: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRPS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRPS2 antibody was raised against the N terminal of PRPS2

Purification: Purified

Immunogen: PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRPS2 Blocking Peptide, catalog no. 33R-6299, is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRPS2

Target: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Alternative Name: PRPS2 (PRPS2 Products)

Synonyms: prsii antibody, PRSII antibody, 2610101M19Rik antibody, AA589463 antibody, AI464149 antibody, Prps-2 antibody, phosphoribosyl pyrophosphate synthetase 2 L homeolog antibody, phosphoribosyl pyrophosphate synthetase 2 antibody, prps2.L antibody, PRPS2 antibody, Prps2 antibody

Background: PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process