UROD antibody (N-Term)

Catalog No. ABIN629827

Product Details anti-UROD Antibody

Target: UROD (Uroporphyrinogen Decarboxylase (UROD))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UROD antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: UROD antibody was raised against the N terminal of UROD

Purification: Purified

Immunogen: UROD antibody was raised using the N terminal of UROD corresponding to a region with amino acids SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UROD Blocking Peptide, catalog no. 33R-8607, is also available for use as a blocking control in assays to test for specificity of this UROD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UROD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UROD

Target: UROD (Uroporphyrinogen Decarboxylase (UROD))

Alternative Name: UROD (UROD Products)

Background: UROD is the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.

Molecular Weight: 40 kDa (MW of target protein)