PRMT1 antibody (Middle Region)

Catalog No. ABIN629816

Product Details anti-PRMT1 Antibody

Target: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRMT1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PRMT1 antibody was raised against the middle region of PRMT1

Purification: Purified

Immunogen: PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRMT1 Blocking Peptide, catalog no. 33R-2736, is also available for use as a blocking control in assays to test for specificity of this PRMT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRMT1

Target: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Alternative Name: PRMT1 (PRMT1 Products)

Background: PRMT1 is a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4.

Molecular Weight: 40 kDa (MW of target protein)