RGS10 antibody (Middle Region)
-
- Target See all RGS10 Antibodies
- RGS10 (Regulator of G-Protein Signaling 10 (RGS10))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RGS10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RGS10 antibody was raised against the middle region of RGS10
- Purification
- Purified
- Immunogen
- RGS10 antibody was raised using the middle region of RGS10 corresponding to a region with amino acids DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
- Top Product
- Discover our top product RGS10 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RGS10 Blocking Peptide, catalog no. 33R-2132, is also available for use as a blocking control in assays to test for specificity of this RGS10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RGS10 (Regulator of G-Protein Signaling 10 (RGS10))
- Alternative Name
- RGS10 (RGS10 Products)
- Synonyms
- MGC82511 antibody, RGS10 antibody, 2310010N19Rik antibody, regulator of G-protein signaling 10 antibody, regulator of G-protein signaling 10 L homeolog antibody, regulator of G protein signaling 10 antibody, regulator of G-protein signalling 10 antibody, RGS10 antibody, rgs10.L antibody, rgs10 antibody, Rgs10 antibody
- Background
- Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-