PUS7 antibody
-
- Target See all PUS7 products
- PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PUS7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- PUS7 antibody was raised using a synthetic peptide corresponding to a region with amino acids FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PUS7 Blocking Peptide, catalog no. 33R-2838, is also available for use as a blocking control in assays to test for specificity of this PUS7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))
- Alternative Name
- PUS7 (PUS7 Products)
- Background
- PUS7 is involved in RNA binding, pseudouridine synthase activity and isomerase activity.
- Molecular Weight
- 75 kDa (MW of target protein)
-