GINS1 antibody

Catalog No. ABIN629812

Product Details anti-GINS1 Antibody

Target: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GINS1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: GINS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GINS1 Blocking Peptide, catalog no. 33R-5986, is also available for use as a blocking control in assays to test for specificity of this GINS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GINS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GINS1

Target: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Alternative Name: GINS1 (GINS1 Products)

Synonyms: CG9187 antibody, CG9187-PA antibody, Dmel\CG9187 antibody, psf1 antibody, GINS1 antibody, zgc:101672 antibody, PSF1 antibody, 2810418N01Rik antibody, Gins4 antibody, mKIAA0186 antibody, RGD1562246 antibody, DNA replication complex GINS protein psf-1 antibody, DNA replication complex GINS protein psf1 antibody, DNA replication complex GINS protein PSF1 antibody, GINS complex subunit 1 antibody, CG9187 gene product from transcript CG9187-RA antibody, GINS complex subunit 1 (Psf1 homolog) antibody, GINS complex subunit 1 (Psf1 homolog) S homeolog antibody, DNA replication protein antibody, NCU02631 antibody, AOR_1_746184 antibody, CC1G_12309 antibody, CTRG_04863 antibody, PAAG_03089 antibody, MCYG_01460 antibody, PITG_00071 antibody, VDBG_04832 antibody, MGYG_04613 antibody, TERG_08027 antibody, gins1 antibody, Psf1 antibody, GINS1 antibody, gins1.S antibody, Gins1 antibody, PSF1 antibody

Background: The GINS complex plays an essential role in the initiation of DNA replication.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: DNA Replication, Synthesis of DNA