HBZ antibody (N-Term)

Catalog No. ABIN629807

Product Details anti-HBZ Antibody

Target: HBZ (Hemoglobin, zeta (HBZ))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HBZ antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Hemoglobin Zeta antibody was raised against the N terminal of HBZ

Purification: Purified

Immunogen: Hemoglobin Zeta antibody was raised using the N terminal of HBZ corresponding to a region with amino acids ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Hemoglobin Zeta Blocking Peptide, catalog no. 33R-2702, is also available for use as a blocking control in assays to test for specificity of this Hemoglobin Zeta antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HBZ

Target: HBZ (Hemoglobin, zeta (HBZ))

Alternative Name: Hemoglobin zeta (HBZ Products)

Synonyms: RGD1307486 antibody, HBZ antibody, hba-l1 antibody, MGC82702 antibody, RA_M008_JSM295ECF antibody, hemoglobin, zeta antibody, hemoglobin subunit zeta antibody, HBZ antibody, Hbz antibody, HBZ1 antibody, hbz antibody

Background: Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes.

Molecular Weight: 16 kDa (MW of target protein)