PHYHIP antibody (N-Term)

Catalog No. ABIN629804

Product Details anti-PHYHIP Antibody

Target: PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHYHIP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PHYHIP antibody was raised against the N terminal of PHYHIP

Purification: Purified

Immunogen: PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids VSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQ

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHYHIP Blocking Peptide, catalog no. 33R-9807, is also available for use as a blocking control in assays to test for specificity of this PHYHIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYHIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHYHIP

Target: PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))

Alternative Name: PHYHIP (PHYHIP Products)

Synonyms: PHYHIP antibody, DYRK1AP3 antibody, PAHX-AP antibody, PAHXAP1 antibody, AW049870 antibody, C630010D02Rik antibody, Lnap1ip antibody, PAHX-AP1 antibody, phytanoyl-CoA 2-hydroxylase interacting protein antibody, phytanoyl-CoA hydroxylase interacting protein antibody, PHYHIP antibody, phyhip antibody, Phyhip antibody

Background: PHYHIP interacts with PHYH suggests a role in the development of the central system.

Molecular Weight: 38 kDa (MW of target protein)