PSD3 antibody (Middle Region)

Catalog No. ABIN629799

Product Details anti-PSD3 Antibody

Target: PSD3 (Pleckstrin and Sec7 Domain Containing 3 (PSD3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSD3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PSD3 antibody was raised against the middle region of PSD3

Purification: Purified

Immunogen: PSD3 antibody was raised using the middle region of PSD3 corresponding to a region with amino acids SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSD3 Blocking Peptide, catalog no. 33R-8378, is also available for use as a blocking control in assays to test for specificity of this PSD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSD3

Target: PSD3 (Pleckstrin and Sec7 Domain Containing 3 (PSD3))

Alternative Name: PSD3 (PSD3 Products)

Synonyms: PSD3 antibody, EFA6R antibody, HCA67 antibody, 4931420C21Rik antibody, AI661273 antibody, BC003498 antibody, D430018P08 antibody, EFA6D antibody, RGD1559968 antibody, pleckstrin and Sec7 domain containing 3 antibody, PH and SEC7 domain-containing protein 3 antibody, PSD3 antibody, LOC100476735 antibody, Psd3 antibody

Background: PSD3 is a guanine nucleotide exchange factor for ARF6.

Molecular Weight: 56 kDa (MW of target protein)