MRGBP antibody (N-Term)

Catalog No. ABIN629797

Product Details anti-MRGBP Antibody

Target: MRGBP (MRG-Binding Protein (MRGBP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRGBP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C20 ORF20 antibody was raised against the N terminal Of C20 rf20

Purification: Purified

Immunogen: C20 ORF20 antibody was raised using the N terminal Of C20 rf20 corresponding to a region with amino acids MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C20ORF20 Blocking Peptide, catalog no. 33R-6018, is also available for use as a blocking control in assays to test for specificity of this C20ORF20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRGBP

Target: MRGBP (MRG-Binding Protein (MRGBP))

Alternative Name: C20ORF20 (MRGBP Products)

Synonyms: C20orf20 antibody, Eaf7 antibody, MRG15BP antibody, URCC4 antibody, c20orf20 antibody, zgc:73167 antibody, 1600027N09Rik antibody, AW060503 antibody, C80444 antibody, MRG domain binding protein antibody, MRG/MORF4L-binding protein antibody, MRG-binding protein antibody, putative mrg-binding protein antibody, MRG/MORF4L binding protein antibody, MRGBP antibody, LOC5577096 antibody, CpipJ_CPIJ006487 antibody, CpipJ_CPIJ017611 antibody, Smp_130630 antibody, mrgbp antibody, Mrgbp antibody

Background: C20orf20 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair.

Molecular Weight: 22 kDa (MW of target protein)