FBP1 antibody (N-Term)

Catalog No. ABIN629795

Product Details anti-FBP1 Antibody

Target: FBP1 (Fructose-1,6-Bisphosphatase 1 (FBP1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: FBP1 antibody was raised against the N terminal of FBP1

Purification: Purified

Immunogen: FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBP1 Blocking Peptide, catalog no. 33R-10289, is also available for use as a blocking control in assays to test for specificity of this FBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBP1

Target: FBP1 (Fructose-1,6-Bisphosphatase 1 (FBP1))

Alternative Name: FBP1 (FBP1 Products)

Synonyms: FBP antibody, Fbp-2 antibody, Fbp2 antibody, Fbp3 antibody, FBP1 antibody, fbp2 antibody, Fdp antibody, CG10611 antibody, CG31692 antibody, Dmel\\CG31692 antibody, FbPase antibody, fbp1 antibody, cb598 antibody, fb57b01 antibody, zgc:64127 antibody, id:ibd1091 antibody, wu:fb17g10 antibody, wu:fb57b01 antibody, fdp antibody, xcc-b100_0105 antibody, fbp1l antibody, fk92h02 antibody, wu:fk92h02 antibody, zgc:64096 antibody, fbp antibody, fbp1.S antibody, fructose-bisphosphatase 1 antibody, fructose bisphosphatase 1 antibody, Fructose-1,6-bisphosphatase antibody, fructose-1,6-bisphosphatase antibody, fructose-1,6-bisphosphatase 1 antibody, fructose-bisphosphatase class I antibody, fructose-1,6-bisphosphatase 1b antibody, fbp antibody, fructose-1,6-bisphosphatase 1a antibody, fructose-bisphosphatase 1 L homeolog antibody, FBP1 antibody, Fbp1 antibody, fbp1 antibody, LOC100136618 antibody, RR_RS07410 antibody, fbp antibody, fbp1b antibody, fbp1a antibody, fbp1.L antibody

Background: Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process, Dicarboxylic Acid Transport