MKRN1 antibody (C-Term)

Catalog No. ABIN629792

Product Details anti-MKRN1 Antibody

Target: MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MKRN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MKRN1 antibody was raised against the C terminal of MKRN1

Purification: Purified

Immunogen: MKRN1 antibody was raised using the C terminal of MKRN1 corresponding to a region with amino acids RYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MKRN1 Blocking Peptide, catalog no. 33R-8272, is also available for use as a blocking control in assays to test for specificity of this MKRN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MKRN1

Target: MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))

Alternative Name: MKRN1 (MKRN1 Products)

Synonyms: MKRN1 antibody, MGC84269 antibody, mkrn1 antibody, Makorin-1 antibody, RNF61 antibody, RFP antibody, makorin ring finger protein 1 antibody, E3 ubiquitin-protein ligase makorin-1 antibody, makorin ring finger protein 1 S homeolog antibody, makorin, ring finger protein, 1 antibody, MKRN1 antibody, LOC100393879 antibody, mkrn1.S antibody, Mkrn1 antibody

Background: The Makorin ring finger protein-1 (MKRN1) is a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Chromatin Binding